PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G008800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 361aa    MW: 41081.5 Da    PI: 7.9325
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G008800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.45.3e-113777948
                        HHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  9 dellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        d +l+ +++q+G+g +W + ++++g++R++k+c++rw++yl
  Phvul.002G008800.1 37 DAKLKAYIEQHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 77
                        5699***********************************97 PP

2Myb_DNA-binding377.7e-1284126246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  Phvul.002G008800.1  84 GGFSEEEDNIICSLYVSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 126
                         569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.343277IPR017877Myb-like domain
PfamPF002493.9E-93777IPR001005SANT/Myb domain
SMARTSM0071713779IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-193784IPR009057Homeodomain-like
CDDcd001672.83E-53777No hitNo description
SuperFamilySSF466895.53E-2163132IPR009057Homeodomain-like
PROSITE profilePS5129421.65478132IPR017930Myb domain
SMARTSM007177.9E-1182130IPR001005SANT/Myb domain
PfamPF002491.5E-1084126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2385132IPR009057Homeodomain-like
CDDcd001676.03E-886128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MRFNHFNLSP LVPLLAPCTR LFSLLFLLIY IYIAPRDAKL KAYIEQHGTG GNWIALPQKI  60
GLKRCGKSCR LRWLNYLRPN IKHGGFSEEE DNIICSLYVS IGSRWSIIAA QLPGRTDNDI  120
KNYWNTRLKK KLLGKQRKEQ QAQARRVSGN RQKQDVKRET ENLIVASELI NQVPYWSAEY  180
SSVPMPVTDV SFQHYGLNNQ TSLRNLMVNK LEGIRFSNDH QQQQQPYTNA CEIPSLPNQV  240
FPTMVNHVAV VSDENNSVTY QPSNVFQGFE NFPSDFCELV CVNSQQMDRS MESFNYGMES  300
MDVMSNGGST NTTSTESTSW GDMSSLVYSP LVSDYEGCRQ GNPRDVVAFE ECKYFGMPMQ  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-203713215108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156687.10.0hypothetical protein PHAVU_002G0088000g, partial
TrEMBLV7CIH30.0V7CIH3_PHAVU; Uncharacterized protein (Fragment)
STRINGGLYMA11G04880.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.14e-59myb domain protein 84